PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 450aa    MW: 50110 Da    PI: 7.5522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613325.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-16121166147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
   XP_009613325.1 121 RGHWRPAEDAKLKELVAIYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 166
                      899*****************************.***********996 PP

2Myb_DNA-binding56.18.7e-18173216146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l  a++++G++ W+ Iar ++ gRt++ +k++w+ 
   XP_009613325.1 173 RRAFTEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 216
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.413116167IPR017930Myb domain
SMARTSM007172.4E-14120169IPR001005SANT/Myb domain
PfamPF002491.7E-15121166IPR001005SANT/Myb domain
SuperFamilySSF466896.97E-28121214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-26122174IPR009057Homeodomain-like
CDDcd001674.49E-13124165No hitNo description
PROSITE profilePS5129427.288168222IPR017930Myb domain
SMARTSM007172.1E-14172220IPR001005SANT/Myb domain
PfamPF002492.9E-14173215IPR001005SANT/Myb domain
CDDcd001672.02E-11175215No hitNo description
Gene3DG3DSA:1.10.10.609.7E-21175221IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MSLSSSTSSS SCSPMSSTSM GMFFADMNSL SITPKHDNES TKTRGSWDFH FLNKGAFSQS  60
LDEAETSEEN NETIDLNASC FNEEKPITMH STPTILKSNS NSSSNIGKEI TETGQSKLCA  120
RGHWRPAEDA KLKELVAIYG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR INRRAFTEEE  180
EERLMAAHRL YGNKWAMIAR LFPGRTDNAV KNHWHVIMAR KYREQSSAYR RRKMGQFIYR  240
RTTVEIDSKS SLFVSSSEEV AEVAMKGETQ TPIISVGQNS ANPFGSLKIN NDGPNGWVVY  300
GPNGSPHMTA SIGEAIPSTK TNVPLLSPYS PFAAPFDTLP GNCGNDAMNI LNQQGRSWER  360
QREASNIITQ HHSLPPSNSL MMMNSMQQSQ YLQFPYSNFS NVTTARAQIP SQVIVKEDRR  420
SSSSDNSQCD QCDTIAPPPP FIDFLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-321212217107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9833310.0HG983331.1 Nicotiana benthamiana mRNA for SANT/HTH Myb transcription factor (SANT/HTH Myb gene), clone 3890.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613325.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0D6DR050.0A0A0D6DR05_NICBE; SANT/HTH Myb transcription factor
STRINGPGSC0003DMT4000474150.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-76myb domain protein 105